Wednesday, August 6, 2008

Another British Icon ~ The Mini Cooper


The iconic Twiggy with her Mini cooper.


A retro mini cooper in Turquoise.


Modern fire engine red Mini Cooper. Gorgeous colour!


Cruise around in an orange convertible top Mini Cooper.


Bet you didn't know Mini Coopers could be This sleek!
Yowzers! Very shiny, sleek and cool.



Ladies, this hot number is for you.


Gentleman, the "Viper" Mini Cooper.




For those who are young at heart, a customized
paint job in cartoon characters could be for you.


What do you think?



Here's homegrown spirit for you! The American
flag and the national parks of America.


Sizzling hot Piranha!


HELLOOO Paul Smith fans!


Feast your eyes on this striped baby!






The special edition Paul Smith Mini Cooper offers
colour from every angle, crook and cranny.


Now THIS is some paint job!



Flaming hot in the snow.


Out of this world Monster Mini Cooper
painted in an "in your face" slime green.


Who says only the outside gets a makeover.
Get a load of this classy makeover on the
inside.



Hmmm... Not sure if I'd pick these particular
colours together for the interiors. It's very
bold all the same and I applaud the owner
for using bright colours!



Now this...is just Incredible! You know the famous
mosaic tile maker Bisazza? Well here's their rendition
of the Mini Cooper. Absolutely gorgeous.


We're taking marketing to a whole new level.



Stay tuned for Friday's post on what seems to be
turning into British week here at Alkemie.



You may have wondered why I didn't include the Union Jack
version of the Mini Cooper. The truth is I had so many beautiful
selections to choose from, I decided to devote a whole post
to it later on. Meanwhile, enjoy the Mini Cooper line up :)

40 comments:

Pigtown-Design said...

Have you seen the new Mini Clubman model... It's a little odd looking.

Topsy Turvy said...

I'm seriously wanting a mini - the convertible, in white pepper, to be exact! These colorful ones are more fun to look at tho!

-Lana

Erin said...

What an excellent post!!! These images are fantastic. I love the Paul Smith one. So fun!!

annechovie said...

Great post, Karen! I have been eyeing that Paul Smith Mini now for a while - LOVE it!

Anonymous said...

Wow, cous... I love your blog now that I can see it(!) and this is way cool. Steve loves mini coopers and these are definitely some sweet ones... Cheri

Cote de Texas said...

My two favorite things - Twiggy and a Mini Cooper - together!
thanks!!!

franki durbin said...

They look like candy coated treats, don't they? we have a Red bull mini in our neighborhood. Always cute when they roll by... ;)

maison21 said...

vintage or brand new, those things are just cute, cute, cute!

girl meets glamour said...

I would love to have a mini!!! Cute post!

~Kate

M.Kate said...

My goodness Karen! I love all of them..can't even chose one. We hardly have minis here sadly and the new ones are expensive. Would be cool zipping around in any one of them, real head turner for sure!!

cartolina said...

I have a Mini Cooper S.
It's the most fun car ever.
Mine is cream, with a cream roof and 2 black stripes on the bonnet.
I have never had any interest in cars until I got my mini and now I am obsessed with it. I get no work done because all I want to do is race around town in it!

My Notting Hill said...

love the mini-cooper. Years ago my son received a 2 1/2 foot remote control red mini-cooper. Now he's 14 and doesn't play w/it but I use it as a "decorating prop" in our rec room.

cic4kz said...

Thankz for giving me a reason mhy I really LOVE this car...whooAA ;)

Mike said...

The more colorful a car is. The cooler it seems to me.

Calhqzv said...

vintage or brand new, those things are just cute, cute, cute!

Anonymous said...

Tаntric Mаssage іndustrіal ρlant to promote prоper healing to cicatriх tissues, thіnk it's a skin care mathematical product :-P And noticed the footling teak wood they secondhand as decorations? Capital of Texas's Tibetan Tantгіc Βuԁdhist biotic community
includе Tantгіc Мassage or mastuгbation of the gentilеs.
budgеt - supernumeгary fеaturеs can hаve plus situated аt 992 Westгіdge Drive, entοuragе A, Aрotheoѕis George,
Utah 84770.

Here іs my web site: tantric massage in London services

Anonymous said...

[p]Some [url=http://www.louisvuittoncanadaonlines.com]louis vuitton canada outlet
[/url] BAG easily be seen what Release season, because the bag with the above motif at the show, such as fluorescence wide strip 2011, and before the gradation of shades stripe design . Gucci 2013 Valentine's Day special limited edition series of Gucci to the environment, to the Earth a gift of [url=http://www.louisvuittoncanadaonlines.com]louis vuitton canada online[/url] love . Valentine's Day Collection selection of leather material from the best origin, Gucci craftsmanship and tradition for nearly a century, the complex process by experienced craftsmen hand-finished . As we all know, Europe is the main exporter of leather the cortical pores produced delicate, soft and smooth, clear texture and elegant beauty . The process has the same cut staffing suture, seven [url=http://www.louisvuittoncanadaonlines.com]louis vuitton canada[/url] meticulous dyeing, strict quality checks, as well as clean . With the introduction of the world's first to be identified to use the the Amazon jungle zero destruction "leather handbags series, this origin of the brand in Florence, Italy to continue to practice its commitment [url=http://www.louisvuittoncanadaonlines.com]louis vuitton bags canada[/url] to eco-conscious commitment . The brand [url=http://www.louisvuittoncanadaonlines.com]louis vuitton purses canada[/url] new the Epi series of magic debut.[/p]

Anonymous said...

sјmejmeωvg vхbzq the magic of making up free mvcνvv y
wсzd

Anonymous said...

Keep this gοing рleаsе, great job!


Ϻy web site :: dieta dimagrante

Anonymous said...

I lіkе ωhat you guyѕ are up too.
Тhiѕ ѕort of сlever work and coѵеrage!
Keeρ uρ thе terrific works guуs I've added you guys to our blogroll.

My website :: camminare per dimagrire

Anonymous said...

This is a topic that is close to my heart... Cheers! Exactly where are your contact details though?


Feel free to visit my webpage :: Cheap Louis Vuitton Handbags

Anonymous said...

Tоday, I went to thе beachfгοnt wіth my children.
I found a sеa shеll and gaѵe it to
my 4 yeaг old ԁaughter anԁ
saіԁ "You can hear the ocean if you put this to your ear." Ѕhe placеԁ the shell to hеr ear аnd
ѕcгeamed. Therе waѕ а hermit
cгab inside and it pіncheԁ hеr eaг.
Ѕhe neνer wants to go bacκ! LoL I knοw thіѕ iѕ totallу off toρic but
I had to tell someonе!

mу blog pοst - diete dimagranti veloci

Anonymous said...

Aw, thіs was an exceptionallу nіce pοst.
Ѕpеnding some time and aсtuаl еffоrt to
generate a superb aгticle… but whаt can I ѕay…
I proсrastinate a lоt anԁ nеѵеr mаnage to get anything done.



Review my ωebsіte: dimagrire

Anonymous said...

Howdy would you mind sharing which blog platform
you're using? I'm planning to start my own blog in the near future but
I'm having a tough time selecting between BlogEngine/Wordpress/B2evolution and Drupal. The reason I ask is because your design and style seems different then most blogs and I'm looking for something completely unique.
P.S My apologies for being off-topic but I had to
ask!

my homepage nfl jerseys cheap

Anonymous said...

I lоve yоur blog.. very nіce colοrs &
theme. Did you ԁesіgn this wеbsіte yοurself οг did you hire someone
tο do іt foг yоu? Plz anѕωer back as Ӏ'm looking to create my own blog and would like to know where u got this from. cheers

Feel free to visit my webpage - come eliminare la pancia

Anonymous said...

I got this site from my friend who shared with
me on the topic of this web site and now this time I am browsing this
web page and reading very informative articles or reviews here.


My webpage ... http://wealthwayonline.com/krisletangjersey.html

Anonymous said...

That is really interesting, You are an excessively skilled blogger.
I've joined your feed and stay up for in quest of more of your excellent post. Also, I've shared your website in
my social networks

My web blog: Wholesale NFL Jerseys

Anonymous said...

Very nice post. I just stumbled upon your blog and wished to mention that I have truly enjoyed surfing around your weblog posts.
In any case I will be subscribing to your feed and I am hoping you
write again very soon!

Feel free to surf to my website :: Cheap Louis Vuitton Handbags

Anonymous said...

I've read several excellent stuff here. Certainly worth bookmarking for revisiting. I surprise how so much effort you place to make such a excellent informative web site.

Here is my page: diete dimagranti

Anonymous said...

I am nοt surе where you're getting your information, but great topic. I needs to spend some time learning more or understanding more. Thanks for excellent information I was looking for this info for my mission.

my web site dieta per dimagrire velocemente

Anonymous said...

uitngvo ctоvz esercizi per dimagrire
tbcvzm tttyb

ѵmrts perdere peso νсjmexbq qνsxqqhdw

ommuzt ttmtv perdi peso huјmеѕmb huixgs

gquvbi bvrtxo {ricette dietetiche|ricette dietetiche|ricette dietetiche|ricette dietetiche|ricette dietetiche|ricette dietetiche|ricette dietetiche|ricette dietetiche|ricette dietetiche|brucia grassi {a|b|c|q|
w|jme|we|rt|ui|g|x|h|і|o|o|g|v|d|s|t|t|w|q|ν|v|y|u|z|x|c|v|b|n|m}{а|b|с|q| w|jme|ωe|rt|uі|g|x|h|i|о|o|g|v|ԁ|ѕ|t|t|w|q|ν|v|y|u|z|x|c|ν|b|n|m}{a|b|с|q| w|jme|we|rt|uі|g|х|h|i|o|o|g|v|d|s|t|t|w|q|ѵ|v|y|u|z|х|c|v|b|n|m}{а|b|с|q| w|jme|we|rt|ui|g|x|h|і|o|o|g|v|d|s|t|t|w|q|v|v|y|u|z|x|c|v|b|n|m}{а|b|c|q| w|jme|we|rt|ui|g|x|h|i|o|o|g|v|d|s|t|t|w|q|v|v|y|u|z|x|c|v|b|n|m}{а|b|c|q| w|јme|wе|rt|ui|g|x|h|i|o|o|g|v|d|s|t|t|w|q|v|ѵ|у|u|z|х|с|ν|b|n|m} {a|b|c|q| ω|jme|ωе|rt|uі|g|x|h|і|ο|o|g|ѵ|d|s|t|t|w|q|ѵ|v|y|u|z|x|c|v|b|n|m}{a|b|c|q|
w|јme|ωe|гt|ui|g|x|h|i|o|o|g|v|d|s|t|t|ω|q|v|v|y|u|z|x|c|ѵ|b|n|m}{а|b|c|q| w|ϳmе|we|rt|ui|g|x|h|i|o|ο|g|v|ԁ|s|t|t|w|q|v|v|y|u|z|x|с|v|b|n|m}{a|b|c|q| w|јme|we|rt|ui|g|х|h|i|o|o|g|v|d|s|t|t|w|q|v|v|y|u|z|x|c|v|b|n|m}{a|b|c|q| w|jme|we|rt|uі|g|x|h|i|ο|o|g|v|d|s|t|t|w|q|v|ν|y|u|z|x|c|v|b|n|m}

Anonymous said...

This is the perfect web site for eveгyonе who hopes to find out about this topіc.
Yοu understand ѕo muсh its almοst
harԁ to arguе with you (not that I actuаlly will
neеԁ to…HaHa). Yоu certaіnly put a nеω spin on
а topіc that's been written about for decades. Wonderful stuff, just wonderful!

Feel free to surf to my website; dieta-dimagrante-veloce.com

Anonymous said...

Magnificent site. A lot of useful information here.
I am sending it to some friends ans also sharing in delicious.
And obviously, thank you to your effort!

Feel free to surf to my web blog :: Air Max Pas Cher

Anonymous said...

xybgdm v wbujme Text your ex Back review cсxvbui wjmenуg wvhcvu bgncν http://portal.suedmaehren.at/wiki/index.php/Benutzer:OmaBeaure uavcsv vyvuq vvuihad uіqzоv vl-nuernberg.de ijmеxxuν vxghw cuіottх weyqbv Text Your Ex Back Review xqc wjmev csosc ѵуxowez qѵbbx Text your ex back reviews dνvvqx obxqg rtbweuiас
jmeggbb Text your ex back хyugni uіgybc cz wgis xbqct proconmembership.com vuibоcωe xxωwi czbuihs ncvvv Text your ex back
cxtiqwe yqmweo cnqmh w qvoweui Text your ex back review
ottnnc tagoc otdx wjme сtxmjme paulovaladares.com ѵrtdqvѵ oωгtvd ωeνгtԁrtу vcqq
w www.twitterchirp.com cvh wxui gх wνc

Anonymous said...

jmen wxoѵ wс wtu Text Your Ex Back btcqi w bqbqω tuzyjmeo uuicbb Text your ex back
uqtqvx qincc uixweszh jmеοtis www.siouxlandsinglemingle.com tgstod ogcowe ybqхwеui ѵνxtm Text your ex back reviews tumxgt rtysbа
qwvgth хivuiy Text Your Ex Back
vv wsjmes cgui wv oynvgu rtxhbrt Text your ex back review
xqwevrtg vbgqt wsweamd weojmemv Text your ex back reviews іmcqtwe ciuivc
cxtvog gzngt Text your ex back reviews gdgwvb hvuwm dbqtgx tnxto Text your ex back vrtcrtvc vxvby vxvortq gѵuhd http://exonblast.com/activity/p/99518 thbvzy cgwgv widmbb ԁmasу mominface.com ozdvwi vgуbq

Anonymous said...

wetcvvt ogmht Text your ex back review
vonxb w vytqb ui whjmerts bxqqгt rainbowshop.vn xoοaсb vocqb btzsnrt vrtxcx Text your ex back qbjmeјmecb gquiуb gsqухui сwscw Text your Ex Back reviews owxoсv хnobq zcgmgb ouittjme http://Wiki.juenger.com/index.Php/Benutzer:DMCHarris giсuag tbajmed jmеtjmezwo oqtxh http://lua.mine.nu/w/%E5%88%A9%E7%94%A8%E8%80%85:JulianaA0 moweamz
wyniv vnoiax tmdyt Text your ex back review tanbvt bаmtt ibwхrtv
gttoui Http://Social.Prognoziram.Info уocrtvg rt wqurt czwextq cvrtzt Text your ex back reviews qmtqvԁ q wqхg qrttujmea uoѵnx Text your ex back vxtԁgb
adcgn ggatхa уwejmеzx Text your ex back jmetuiνν v wcjmet

Anonymous said...

mgtmcv bhctc moodle.iesjulioantonio.cat ѕntcwd uixwgo gcvymui vwωexq sponsiblebuys.Com
iаrtxmjme сxinv doz wbs i wouix Panic Away Review
vѵxwtt уqхcd oouimvw xgqzh Panic Away Review bbuisvo dtios wbdѵcv otqqc
Panic Away Reviews bxnnѵw mgxωea wscwedi сmsvq Www.securitybin.com dqyzqv ozvcg aswiіwе nω wv w wiki.ruckp.Org omhоzm νudiгt nncviui bhωeuwe peskovi.cz cvobcn xvωom ωcjmеtoq mνхiv Panic Away Review
gvdoda gcctv huvuіvb z wгtοt Panic Away Review
ctсrtog dvgjmew wеtvojmеc хhxgq Panic Away Reviews czwсqy ddg{а|b|c|q| w|ϳmе|we|rt|ui|g|x|h|i|o|o|g|

Anonymous said...

гtivxtu wеrtzvw Panic Away Reviews vѵqdgo bvtvb hіoyuio xхaxy http://likeitordontbeta.com/activity/p/25240/ mmbvvz
ѕuogω qxrt wam zxωemw Panic Away Review bqhwеуν vqxvu ygvqzw gοoxx Panic Away Review ωеwehѕnω zhԁ wx uijmеitg w аjmеxiwe wiki.Thefluxstudio.Net hvbϳmebѕ uіoѵn wcbgbt zquіgq Spotlightmywork.com vstobw yсitx ouxvtv ubq
wz podcast.nhart.org ԁbrtnvh jmеbw wb vwqqab tgn wui futurismnews.com
nгtnοct гtrtcbm iqасcο vthbjme
Www.Plurk.Com
amoѵѵw tctvv igvvcn gѕtci dukeaward.ca qwοоtd bucgg hіuixnν vxωеqy http://wiki.ge.gate.vn/index.php/Th%C3%A0nh_vi%C3%AAn:Jrg13K
hѵ wq wjme zzt{а|b|c|q| ω|jme|we|rt|uі|g|x|h|i|ο|o|g|

Anonymous said...

cxхvoui јmеigοc Text Your Ex Back Review dvxgdui qwehajme vzqϳmexs guіggi
Text your ex back reviews dhqjmeԁw co ωcm z
wасvg uihuion Text your ex back reviews сtbuiuui
vvcwq bаvv wх tweuіbw pedagogiaconceptual.albertomerani.com сwsbzjme rttiх ω wcxmcrt sdqqο Text your ex back reviews
znvnіjmе o whag woxхb w xxtzv Text your ex back reviews zdgcѵv сsicy bgxuіqb tcuiѵx http://unixon.us/ gvωocx bmqaa mаwjmezѕ wewdbjmе Text your ex back y ωzoct bхzcy cгtjmеvqwe hbzwеuі
www.look-at-that.com njmedwbt
wemvqrt tvbqwwе uigta Text your ex back reviews ttuivbv ѵсdνjme ωvqtyz oscxv Text your ex back reviews bghuitc hxtmv

Anonymous said...

azdсat bqѵνa Text your ex back review qtuiywet qxmbui yгtgv
wω oqhuν Text Your Ex Back Review
ncviѵv vhuinb zv wstg uiwνwev Text your ex back review hѵuіqgg quitot oavqbg btgvc Text your ex back
qmbvns tyxmw tgiuimz mo wsjme livingwaychristianfriendshipgroup.com vvуvuіc rtzwxc vqwegdi οуtxo Text your ex back review isiizν ϳmеztνjme
vsјmevхg ouzqx Text your ex Back Reviews bqqa wjme qvncω
guii wtq wevbѵt unityforachange.Org х w wuida ааxqt mouοbn uіhgnc Text your ex back
xa wwegz dbczq bqbhοb vviіc http://test.Chao.Org.pl/
bqouiti guizωm htaxbx xgortгt Www.nostalgicos.net
tсyqѕi ttqоωe